PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA5G00117
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family LFY
Protein Properties Length: 423aa    MW: 47129.7 Da    PI: 6.8247
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA5G00117genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY620.23.7e-18913921386
    FLO_LFY   1 mdpeafsaslfkwdpraaa..aapparlleeaavseapleaaaaaaarklr..eleelfkayGvryltvakiaelGftvstLvdmkdeelddlmkslsei 96 
                mdpe f++slf+wdp  a+  ++pp++ +++ +  +++++ +a  aa  +r  +le lf ayG+ry+t+akiaelGft+stLvdmkdeel+d+m+sls+i
  AA5G00117   1 MDPEGFTSSLFRWDPTRAMvhQSPPQQHQQTPQPLQPQSQPQALPAAFGMRlsGLEGLFCAYGIRYYTAAKIAELGFTASTLVDMKDEELEDMMNSLSHI 100
                9*************655443444555555544444444444444444444444*********************************************** PP

    FLO_LFY  97 frldllvGeryGikaavraerrrlee..eeaekkrrkll.....sedeet.aldalsqeglseepvqeekeaagsggeglgeaelvaaeekkseeekkka 188
                fr++llvGeryGikaavraerrrl+e  ee++++rr+ll     + d+ +  ldalsqeglseepv++++++++ +++  g+ +      ++++ + kk+
  AA5G00117 101 FRWELLVGERYGIKAAVRAERRRLQEeeEEEASRRRHLLissavAGDSGAhGLDALSQEGLSEEPVHHQENDVAGNNGDGGSGGYWEGG-QSMTVKIKKQ 199
                ************************9954444567777666776656665559**************99666544444443444444444.3333333333 PP

    FLO_LFY 189 skkkqkrkkkkelkseededeeeeededeegsgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiakerGekcPtkvtnqvfry 288
                   +++rkk   + +  d+ ++ +e+ ++e+++  g erqrehPfivtepgevargkknGLDYLf+LyeqCr+fLlqvq+iak+rGekcPtkvtnqvfry
  AA5G00117 200 ---QRRRKKP--IDNGGDNGDDVTENGEDEEGTGFGIERQREHPFIVTEPGEVARGKKNGLDYLFHLYEQCRDFLLQVQTIAKDRGEKCPTKVTNQVFRY 294
                ...3333333..3344444444444445555555699*************************************************************** PP

    FLO_LFY 289 akkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprLsiWYvPtkLrqLChlerskas 386
                akk+gasyinkPkmrhYvhCYalhcLde+asnalrrafkergenvG+wrqacykplv+ia r+gwdidavfnahprLsiWYvPtkLrqLCh+er++a+
  AA5G00117 295 AKKSGASYINKPKMRHYVHCYALHCLDEDASNALRRAFKERGENVGSWRQACYKPLVDIACRHGWDIDAVFNAHPRLSIWYVPTKLRQLCHAERNNAV 392
                **********************************************************************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016986.0E-1921391IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 423 aa     Download sequence    Send to blast
MDPEGFTSSL FRWDPTRAMV HQSPPQQHQQ TPQPLQPQSQ PQALPAAFGM RLSGLEGLFC  60
AYGIRYYTAA KIAELGFTAS TLVDMKDEEL EDMMNSLSHI FRWELLVGER YGIKAAVRAE  120
RRRLQEEEEE EASRRRHLLI SSAVAGDSGA HGLDALSQEG LSEEPVHHQE NDVAGNNGDG  180
GSGGYWEGGQ SMTVKIKKQQ RRRKKPIDNG GDNGDDVTEN GEDEEGTGFG IERQREHPFI  240
VTEPGEVARG KKNGLDYLFH LYEQCRDFLL QVQTIAKDRG EKCPTKVTNQ VFRYAKKSGA  300
SYINKPKMRH YVHCYALHCL DEDASNALRR AFKERGENVG SWRQACYKPL VDIACRHGWD  360
IDAVFNAHPR LSIWYVPTKL RQLCHAERNN AVAAASALVA GINCSGSAVA SARGGCGGDQ  420
LHY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1282294231194PROTEIN LEAFY
2vy2_A1e-1282294231194PROTEIN LEAFY
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF4369561e-153JF436956.1 Arabis alpina LFY (LFY) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010457882.10.0PREDICTED: protein LEAFY isoform X2
SwissprotQ009580.0LFY_ARATH; Protein LEAFY
TrEMBLQ6XPU80.0Q6XPU8_IONAC; LEAFY-like protein
STRINGBra029305.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79072841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.10.0floral meristem identity control protein LEAFY (LFY)